- SHPRH Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92387
- 0.1 ml (also 25ul)
- Unconjugated
- Human
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: KKNPQHLYSF IAKILWRSAK KDVIDQIQIP PQTEEIHWLH FSPVERHFYH RQHEVCCQDV VVKLRKISDW ALKLSSLDRR TVTSILYPLL
- SHPRH
- RAD5, bA545I5.2
- SNF2 histone linker PHD RING helicase
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- DNA Repair
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KKNPQHLYSFIAKILWRSAKKDVIDQIQIPPQTEEIHWLHFSPVERHFYHRQHEVCCQDVVVKLRKISDWALKLSSLDRRTVTSILYPLL
Specifications/Features
Available conjugates: Unconjugated